ChemicalsPharmaceuticalsVietnam KHAI THE KY TRADING SERVICE CO., LTD

KHAI THE KY TRADING SERVICE CO., LTD

Company Details

  • Operational Address : 277 Minh Phung, Ho Chi Minh, Ho Chi Minh City, Vietnam
  • Business Type : Trading Company
  • Location : Ho Chi Minh, Vietnam
  • Year Established : 2008
  • Main Markets : Domestic Market 80.00% Southern Europe 5.00% South Asia 5.00%
  • Main Products : Amino Acid,Cosmetic Materials,Drug Peptides, Protein,Peptide,, Cosmetic Materials,Drug Peptides, Bodybuilding,Protein,Muscle Products, Health Products,Polypeptide, ,
  • Links : Vietnam Chemicals, Vietnam Pharmaceuticals,

    • Company Introduction

    Company Information

  • Contact Person : Mr. The Ky Khai
  • Job Title : Director
  • Telephone :
  • Fax Number :
  • Address : 277 Minh Phung
  • Zip/Post Code : 700000

    • Company Product

      2017 HGH Stock Different Types 10iu/Vial Somatotropin High Quality HGH
      2017 best China hgh, High quality Hgh human growth hormone for bodybuilding
      2017 10iu/Vial Somatotropin High Quality HGH for human growth hgh
      2017 Lyophilized Peptide hGH Frag 176-191 for Bodybuilding
      High Quality HGH 10iu/vial,Hgh Human Growth
      best sell hot bodybuilding hgh 10iu hormone
      hgh human growth hormone ,somatotropin 191AA,china best sell
      china best sell hot product MT2,melanotan,black beauty product
      china best sell hot product ghrp6,hormone
      ,2017 10iu/Vial Somatotropin High Quality HGH for human growth hgh
      2017 Pharmaceutical Peptide Follistatin 344, Follistatin-344
      99% Bodybuilding Peptides Powder cjc 1295 with dac
      99% purity cjc without DAC Peptide cjc 1295 for Bodybuilding
      Pharmaceutical Grade Thymosin Beta-4 CAS No. 77591-33-4 TB 500 peptide
      Pharmaceutical Grade Semorelin
      CAS 189691-06-3 quality Bremelanotide 99% Peptide PT 141
      PEG-MGF 2mg, PEG MGF, Pegylated Mechano Growth Factor
      2017 new MGF powder china peptides MGF with a large stock
      Lyophilized Powder Melanotan II CAS:121062-08-6 Peptides Melanotan2 Acetate
      China Factory Directly Supply melanotan1, melanotan 1 powder, melanotan 1 peptides
      China 99% Purity Peptide Ipamorelin
      Fast delivery hgh HMG 75iu vial
      Lyophilized Peptide hGH Frag 176-191 for Bodybuilding
      Hexarelin Acetate, Bulk Hexarelin, Best price Hexarelin
      HCG 5000iu hcg 2000iu vial 2017 hot selling
      Bodybuilding Healthy Medical Peptides peptide Powder Gdf-8
      99% purity ghrp2 ghrp-6 powder peptide ghrp6
      Ghrp GMP manufacturer polypeptides bodybuilding Ghrp6 Ghrp2
      powder IGF DES 1mg/vial 10 mg vial from China the best peptide hormones powder
      IGF-1LR3,high quality IGF-1lr3
      Stock Different Types 10iu/Vial Somatotropin High Quality HGH
      china best sell hot product ghrp2,ghrp6,high purity product 99% ghrp2
      china best sell hot product tb500,high purity product 99% tb500,77591-33-4 Peptide Thymosin Beta 4
      Pharmaceutical Hormone Peptide Cas 170851-70-4 Ipamorelin,top grade ipamorelin,high quality
      china best sell hot product mgf 2017 new MGF powder china peptides MGF with a large stock
      china best sell hot product SERMORELIN, SERMORELIN ACETATE, YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2

    Related Company

    New Companies

    © 2023 COMPANY-LISTING.ORG. All Rights Reserved.    Contact Us