Animal Fats Companies

Browse by:

  • MANORAMA INDUSTRIES PRIVATE LIMITED

    F-6, Anupam Nagar

    Manorama&＃39;s Promoters has a four decade combined cross functional experience in collection, processing and export distribution Mango, Sal Wild Exoitic tree borne oilseds as our traditional butinsess. Manorama is manufacturing, exporting, Mango Butter, Fats, Stearine, Oleine, stearine, Kokum Mowrah Fat, Tailor made ...
    Sal Butter,Mango Butter,Kokum Butter,Mowrah Fat,Herbal Seed, Bird Feed, Other Beauty & Personal Care Products, Edible Oil Extraction, Oils and Fats for Confetionery, Animal Feeds and Fertilizers, Animal Feeds, Oils & Fats for Cosmetics /Chocolates

  • Nagle Samson PET Supply

    25 Bloemkom Street Riversdal, Western Cape

    We deal with rare plants and animal oils or fat.We also sell grinned crushed bones.Please contact us if you looking for specific plant oil.Rare plants. Rare Plants skins.We are the best when it comes to forest agricultural products. Our current product in market is Python Fat Oil. breed our own Pythons extraction which make quality ...
    Animal Oil, Animal Fats, Crushe animal bones, plant oil

  • Spectra Foods

    19150 Cruickshank Ave.

    We have been supplying the foodservice industry in Quebec and Ontario provinces for over 35 years. Our Spectra, Golden Alfa brands become synonymous with incomparable quality, exceptional reliability outstanding value that has put us forefront of our industries. ...
    Canola and Vegetable Oils and Liquid Shortenings, Margarines, Animal Fats and other shortenings, All purpose Shortening (20Kg),Edible Fats & Oils

  • Leather Art Ltd.

    12E Chavdar Str.

    wet salted pig skins,melted animal fats,

  • JRT Service

    21 Kirsten Drive, Freehold, New Jersey, USA,07728

    JRT Services started as a transportation broker in the soil business both contaminated and clean New Jersey surrounding states. has evolved into buying selling any type of marketable products worldwide. 2011 environmental products, fuel reducing financing equipment renewable energy markets - such solar, bio-diesel fuels, ...
    methanol, vegetable oils, animal fats, astm b100, off spec b100, glycerin, milk fat

  • IDSys Sdn Bhd

    Suite C-8-7, 10th Floor Menara Uncang Emas (Ue3) , 85, Jalan Loke Yew

    We are agents for a trading community of products ranging from1. Crude and refined palm oil2. Carbon based products3. Activated carbon4. Health care products5. Copper cathode6. Sugar7. Other industrial consumer products8. IT Products including Smart Cards RFID LabelsWe now positioned to deliver everything the global market ...
    Plant & Animal Oil, Charcoal, Carbon, Lables, Rifd,Non-ferrous Metal, Meat & Poultry, Health Care, Measurement & Meter, ,, Herbs & Natural Remedies, Herb Medicine, Iron & Steel, Fertilizer, Software, Consumables, New Product, IC Card, Plant & Animal Oil, Ester, Health Care Products, Electronic Component, Charcoal, Metallic Processing Machinery, Home Healthcare Equipment, Household Gloves, Water Softener and Purifier, Non-ferrous Metal Products, Fuel Oil, Auto Accessories, Coke, Consumable, Edible Fats & Oils, Sugar & Sweeteners, Activated Carbon, Environment Product Agents, Water Treatment, Label & Tag, Animal Fodders, Plant Extract,

  • Qingdao HengFa tallow and chemical CO., LTD

    fuzhou north road, Qingdao, Shandong, China,266071

    our company produce and supply many grades of tallow(beef fats, sheep fats pig etc.), the top grade tallow can be edible other used to cosmetic animal feed, soap, fatty acid chemical additives, we also according buyer's index requirement.moreover, kinds oils, such as vegetable restaurant oils machine oils. ...
    tallow, animal fats, sheep fats and bull fats, vegetable oils, used oil

  • Oil Factory Nigeria Limited

    17, Oghale Stree, Off Sapele Road

    OIL FACTORY NIG LIMITED Export / Supply the highest and finest quality of all types edible oil such as vegetable Oils, Crude Oil, Animal Oil. We can supply your need at earliest convenience. 500, 000 Metric tons in a Year more than 40, month. sell our very good competitive price. have guarantee not only terms but also shipments timing, ...
    Edible Fats & Oils, Plant & Animal Oil,Edible Fats & Oils,

  • Demi tech a

    tudentgatan 8 �ebro,

    Demi Tech is an swedish company specialized in wholesale of oils, fats and chemical products for food- and chemical industries manufacturers.www.demitechab.se
    tallow, lard, animal fats, cat 3

  • Darmokrik Tatyana (Russian Federation)

    Partizanskaya st 105

    Russian Healthy Product,Herbs, Brakshun, Animal Extracts, Devices, Balm, Artemia, Fern, Oils, Badyaga, Cedar And Larch Healing Products, Bee Products, Animal Fats, Animal Extracts, Mumijo,

  • MSD GLOBAL

    7/102, Saki Vihar, Andheri (E)

    We derive pleasure in introducing ourselves as an International Trading Company specializing supplies of soap noodles, distilled fatty acids, acid fractions, distillates, edible oil, glycerine, specialty fats, Fatty alcohols and oleochemical derivatives various grades produced from Palm Oil, Kernel Oil & Coconut Oil.We ...
    oap noodles,stearic acid,PFAD,glycerin 99.7% USP grade,shortening,Methyl Esters, Hydrogenated palm stearin, Fatty Acid Fractions, Acid oil, RBD vegetable oils, Edible oils and speciality fats, RBD Vegetable oils, Palm wax, Fatty alcohol, Fractionated Fatty Acids, Speciality Fats, Animal Feed, Amides and Betaines, Glycerine, Fatty Acid distillates, Distilled Fatty Acids, soap noodles,

  • Higher Ground Energy Solutions, Inc

    602 sweetwater ave, florence, alabama, USA,35630

    wddkhfeikncwoihiwhiinifknidsancidnirenkvniriwidekfmfnfjfjfjfjfkdddmdmjejejenemelldkfjffnremememjfjfjfjmnfnrerjekjkfkfmrfnrenrejf
    lush toys, cullet, animal fats, feedstocks, bio-diesel

  • Biovawe

    lechonia

    spanish wine,spanish olive oli,animal fats,

  • 2skebengas Co.

    34701 Tranquiview Lane

    No profile
    Fruit Juices, Citrus Spirits, Fresh Fruit, Scrap Metals, Animal Fats, Biodiesel, Fusel Oil,Scrap Rails and HMS1

  • Nishty Cor

    5250 W. Century Blvd, LA, CA, USA,90045

    We can supply large scale volumes of sugar and have good competitive prices. are not so much interested in low volumes, minimum 25, 000 metric tons per month sugar--"ICUMSA 45" is the standard around world what we mainly sell, but provide brown other refinements-- pur optimal 50, to 300, range.Also soybean oil, palm sunflower ...
    ugar "icumsa 45", oil, sunflower oil, edible (agricultural) oils, animal fats, soybean oil, palm oil, feedstcosk for biodiesel, ethanol, biodiesel, and other related products.

  • Moorgate Proteins

    Parnu Mt 30-6

    Moorgate Proteins Ltd supplies a range of quality protein products, including meat and bone meal, feather meal, fish meal, porcine meal, blood meal, fats and oil.
    Meat and Bone Meal 45% Cat 3,Meat and Bone Meal porcine,Blood Meal bovine,Blood Meal porcine,Poultry Meal,Feather Meal,Fish Meal 62%,Fish Oil,Animal Fats,

  • HM GLOBAL TRADING

    Kota Kinabalu, Sabah, Malaysia

    almond oil sweet, castor oil, corn oil, cottonseed oil, olive oil, peanut oil, safflower oil, sesame oil, soybean oil, animal fats edible beef tallow

  • Milantre Grupp OU

    Oismae tee Tallinn, Harjumaa

    Milantre Grupp is a trading company in the field of fertilizers and animal by-products. Our products are renowned for high digestibility and purity. Our exported animal by-products include:MEAT AND BONE MEAL (MBM); FISH MEAL; FISH OIL; BLOOD MEAL; ANIMAL FATS.
    Meat Bone Meal, Animal Fats, Used Vegetable Oil, Fish Meal, Fish Oil, Blood Meal

  • AGRO-TOP Ltd.

    Ko. Grezowka 34B, LUKOW, lubelskie, Poland,PL 21-400

    Agro-Top is a considerable business partner in the field of animal fats with production capacity 25 000 mt per year.Years experience sourcing, melting, and use have made us an expert our branch.Our mission to keep leader position on Polish fat market. We want meet needs requirements partners by building long term relationships ...
    animal fats, lard, greaves, liquid fat

  • Yuangsue Oil Production Intl.

    No. 30 nwaigwe avenue, off nnamdi azikiwe road old orlu road Owerri-nkwoji Owerri, Imo state

    Our company is a supplier of oils and fats since 1826. We offer Refined, USP/NF, Crude Kosher (where applicable) vegetable oils, animal fats, fatty acids, other for various industries.We are cGMP certified registered by the Asian Food Drug Administration (AFDA),we also member World health Organization,(W.H.O) as drug ...
    NF/USP OILS, VEGETABLE OILS, ANIMAL FATS, Fatty Acid

New Companies

© 2023 COMPANY-LISTING.ORG. All Rights Reserved.    Contact Us